Menu

PTV Group Logo
  • Produkter
      • Vis alle produkter
      • PTV Visum Den førende software til multimodal transportplanlægning og makroskopiske trafiksimuleringer
      • PTV Vissim Simulera realistiskt och levande multimodal och mikroskopisk trafik
      • PTV Vistro Realistically and vividly simulate multimodal and microscopic traffic
      • PTV Viswalk Realistisk simulere og vise fodgængeres adfærd
      • PTV MaaS Modeller Beregn effektiviteten af ​​din Mobility as a Service business case
      • PTV Balance & PTV Epics Optimer trafiklys og implementer et trafiktilpasningsstyringssystem
      • PTV Maps & Data Leverage the full potential of your PTV Software with our customised maps and data bundles
      • PTV Route Optimiser Rutning og planlægning samt ruteoptimering under hensyntagen til alle truckattributter og begrænsninger
      • PTV Map&Guide Effektiv lastbilplanlægning og beregning af transportomkostninger
      • PTV xServer Udviklerens værktøjssæt til tilpasselig og integreret ruteoptimering, kortvisualisering, geokodning og mere
      • PTV Map&Market Analyser territorier og placeringer og planlæg optimerede ruter til felttjeneste
      • PTV Navigator Professionel navigation - Før lastbiler og varevogne hurtigt og sikkert til deres destinationer
      • PTV Drive&Arrive Beregn pålideligt estimerede ankomsttider (ETA) for transporter og øg effektiviteten fra afsender til rampe
  • Ekspertise
      • Air Quality
      • Automotive Simulation
      • Freight & Transport
      • Microsimulation
      • Mobility Services
      • Pedestrian Simulation
      • Road Safety
      • Traffic Engineering
      • Transport Infrastructure Planning
      • Urban Mobility
  • Consulting
      • PTV Transport Consult
  • Om PTV Group
      • Firmaprofil
      • Tilknyttede virksomheder
      • Lokationer
      • Careers
      • Academia
      • Research
  • Ressourcer
      • Blog
      • Arrangementer
      • Resource Library
      • Newsroom
      • Service & Support
      • PTV Trainings
  • Produkter
      • Vis alle produkter
      • PTV Visum
        • Areas of Application
          • Transportation Planning
          • Public Transport Planning
          • Future Mobility
          • Large Scale Simulation
        • Release Highlights
        • Why PTV Visum?
        • Demo Version
        • References
        • Knowledge Base
        • Contact
      • PTV Vissim
        • Areas of Application
          • Traffic Flow Simulation
          • Advanced Traffic Management Systems
          • Multimodal Systems
          • Autonomous Vehicles and New Mobility
          • VR Traffic Simulation
        • Why PTV Vissim?
        • PTV Vissim for Linux
        • Demo Version
        • Knowledge Base
      • PTV Vistro
        • Overview
        • Traffic Impact Analysis
        • Traffic Signal Operations
        • Release Highlights
        • Why PTV Vistro
        • Vistro Demo
        • Knowledge Base
          • Feature and Use Cases
          • Self-Learning
          • Web and Video Training
          • Urban Mobility System
      • PTV Viswalk
      • PTV MaaS Modeller
      • PTV Balance & PTV Epics
      • PTV Maps & Data
        • PTV Traffic Data
          • Road Network Data
          • Floating Car Data
          • Real-Time Traffic Data
          • Validate
        • PTV Logistics Data
          • Maps
          • Toll data
          • Low emission zones
          • Traffic patterns
          • Truck restrictions
          • Dynamic traffic information
          • Preferred routes
        • PTV Data Analytics
        • Contact
      • PTV Route Optimiser
        • Overview
        • Funktioner
          • Automatisk fordeling af ordrer
          • Flere brugergrænseflader
          • Optimering af ruter
          • Tag højde for restriktioner
          • Beregn transportomkostningerne
          • Send ETA til dine kunder
        • Fordele
          • Spar på omkostningerne
          • Overblik over transportplanlægningen
          • Formindsk planlægningstiden
          • Optimal lastning af køretøjerne
          • Forbedring af din kundeservice
        • Referencer
        • Brancher
          • Logistik
          • Grossist
          • Food & Detail
          • Køkken & Møbler
          • Field Service
          • Persontransporter
          • Trombosetjenester
          • Foged
        • Tillægsmoduler
          • Notifikationer
          • Multi-User
          • Telematics
          • Drive&Arrive inkl. Driver App
          • Multi-Dima
          • Lastbils Attributter
          • Road-editor
          • Historisk trafikinformation
          • Beregning af fragtomkostninger
          • Sammenlign
        • FAQ
        • Customer Area
        • Contact
      • PTV Map&Guide
      • PTV xServer
      • PTV Map&Market
      • PTV Navigator
      • PTV Drive&Arrive
  • Ekspertise
      • Air Quality
      • Automotive Simulation
      • Freight & Transport
      • Microsimulation
      • Mobility Services
      • Pedestrian Simulation
      • Road Safety
      • Traffic Engineering
      • Transport Infrastructure Planning
      • Urban Mobility
  • Consulting
      • PTV Transport Consult
  • Om PTV Group
      • Firmaprofil
      • Tilknyttede virksomheder
      • Lokationer
      • Careers
      • Academia
      • Research
  • Ressourcer
      • Blog
      • Arrangementer
      • Resource Library
      • Newsroom
      • Service & Support
      • PTV Trainings
  • Contact

PTV Vistro

  • Traffic Impact Analysis
  • Traffic Signal Operations
  • Release Highlights
  • Why PTV Vistro
  • Vistro Demo
  • Knowledge Base
    • Feature and Use Cases
    • Self-Learning
    • Web and Video Training
    • Urban Mobility System
  • Self-Learning and Exploration Center

    Welcome to PTV Vistro Self-Learning and Exploration Center. Here you will find an array of detailed trainings and tutorials to help you explore PTV Vistro's functionality and apply these concepts to your projects.

  • Teaserbox
    Traffic Signals - Advanced Training

    In this comprehensive training, explore how to setup Traffic Signals in PTV Vistro. Vistro’s powerful traffic signal workflow features make for an unparalleled experience. Moreover, your traffic signal controller setup is verified visually with the sequence and phase diagrams and signal group arrows in the network editor.

  • Teaserbox
    Alternative intersections - Setup Tutorial

    In this tutorial, explore how to think outside-of-the-box, model, analyze, and document project decisions for innovative interchange and alternative intersection designs. Today’s transportation challenges push engineers to do more with less. Innovative solutions are required to solve these complex transportation problems.

  • Teaserbox
    Traffic Impact Analysis (TIA) and studies - Basics Tutorial

    Evaluating a traffic impact analysis on your transportation network for new developments is easy with PTV Vistro. Vistro’s integrated workflows allow you to generate, distribute, and assign project trips quickly.

  • LinkedIn
  • Facebook
  • Twitter
  • Instagram
  • Youtube

  • COVID-19 Response
  • Contact
  • Service & Support
  • Terms & Privacy
  • Cookie Preferences
  • Imprint